PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_35104-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 396aa    MW: 45616.2 Da    PI: 7.2371
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_35104-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.21e-09301344447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      WT+eE+  ++++   +G g Wk I++ +  ++t+ q+ s+ +ky
  TRIUR3_35104-P1 301 WTKEEHWNFLHGLSVYGRGKWKEISKDFVSTKTPVQVSSHAHKY 344
                      *****************************99***********99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.519293349IPR017930Myb domain
SuperFamilySSF466894.93E-14296350IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-11297347IPR006447Myb domain, plants
SMARTSM007172.1E-7297347IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-9300346IPR009057Homeodomain-like
PfamPF002491.4E-7301344IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MDARVSVEEA RLIITRFNNK GSGSNRANRN NYDNKPDTKL RMWYPCETMK QDAMRVMEKG  60
KGVIAVTKEN EVEALENKMS TYEPVITPST RNDWAQEEHC SLWSVVNGRV SVQEPRSIIT  120
GFNNKESISD GANQNTYNKK PDTKLRLWYP CETMQKDVMD KGKGVIAMTE ENKVEALENN  180
MSTHQPVIAP SARNYWTQEE HWSLWYAMNA RVGVEEPGSI ITGFNNKESS PIDGNNSKYN  240
NKPDTELRMQ YHCESMQQEG TRVMEESNDV IAMSEDNNVE VLENEMSIRQ PVIVPSARIY  300
WTKEEHWNFL HGLSVYGRGK WKEISKDFVS TKTPVQVSSH AHKYFKRLQR KNLRRRYSIN  360
DLGLEMAEPL IMENSSSARQ SRILGDVNNR NPSFGL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM7YFI30.0M7YFI3_TRIUA; Myb-like protein J
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP84230133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.16e-18MYB family protein